VASH1 purified MaxPab mouse polyclonal antibody (B01P)
  • VASH1 purified MaxPab mouse polyclonal antibody (B01P)

VASH1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022846-B01P
VASH1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human VASH1 protein.
Información adicional
Size 50 ug
Gene Name VASH1
Gene Alias KIAA1036
Gene Description vasohibin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATDLPKIPIPSVPTFQPSTPVPERLEAVQRYIRELQYNHTGTQFFEIKKSRPLTGLMDLAKEMTKEALPIKCLEAVILGMYPSSPEGEGSGLLWASASCSESEGGVG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen VASH1 (AAH09031.1, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22846

Enviar uma mensagem


VASH1 purified MaxPab mouse polyclonal antibody (B01P)

VASH1 purified MaxPab mouse polyclonal antibody (B01P)