SIAHBP1 monoclonal antibody (M02), clone 3H1
  • SIAHBP1 monoclonal antibody (M02), clone 3H1

SIAHBP1 monoclonal antibody (M02), clone 3H1

Ref: AB-H00022827-M02
SIAHBP1 monoclonal antibody (M02), clone 3H1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIAHBP1.
Información adicional
Size 100 ug
Gene Name PUF60
Gene Alias FIR|FLJ31379|RoBPI|SIAHBP1
Gene Description poly-U binding splicing factor 60KDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq VYVGSIYYELGEDTIRQAFAPFGPIKSIDMSWDSVTMKHKGFAFVEYEVPEAAQLALEQMNSVMLGGRNIKVGRPSNIGQAQPIIDQLAEEARAFNRIYVASVHQDLSDD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIAHBP1 (NP_055096.2, 114 a.a. ~ 223 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22827
Clone Number 3H1
Iso type IgG2a Kappa

Enviar uma mensagem


SIAHBP1 monoclonal antibody (M02), clone 3H1

SIAHBP1 monoclonal antibody (M02), clone 3H1