RASA3 purified MaxPab rabbit polyclonal antibody (D01P)
  • RASA3 purified MaxPab rabbit polyclonal antibody (D01P)

RASA3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022821-D01P
RASA3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RASA3 protein.
Información adicional
Size 100 ug
Gene Name RASA3
Gene Alias GAP1IP4BP|GAPIII|MGC46517|MGC47588
Gene Description RAS p21 protein activator 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAVEDEGLRVFQSVKIKIGEAKNLPSYPGPSKMRDCYCTVNLDQEEVFRTKIVEKSLCPFYGEDFYCEIPRSFRHLSFYIFDRDVFRRDSIIGKVAIQKEDLQKYHNRDTWFQLQHVDADSEVQGKVHLELRLSEVITDTGVVCHKLATRIVECQGLPIVNGQCDPYATVTLAGPFRSEAKKTKVKRKTNNPQFDEVFYFEVTRPCSYSKKSHFDFEEEDVDKLEIRVDLWNASNLKFGDEFLGELRIPLKVLRQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RASA3 (NP_031394.2, 1 a.a. ~ 834 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22821

Enviar uma mensagem


RASA3 purified MaxPab rabbit polyclonal antibody (D01P)

RASA3 purified MaxPab rabbit polyclonal antibody (D01P)