ITGA11 polyclonal antibody (A01)
  • ITGA11 polyclonal antibody (A01)

ITGA11 polyclonal antibody (A01)

Ref: AB-H00022801-A01
ITGA11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGA11.
Información adicional
Size 50 uL
Gene Name ITGA11
Gene Alias HsT18964
Gene Description integrin, alpha 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LDARSDLPTAMEYCQRVLRKPAQDCSAYTLSFDTTVFIIESTRQRVAVEATLENRGENAYSTVLNISQSANLQFASLIQKEDSDGSIECVNEERRLQKQVC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA11 (NP_001004439, 793 a.a. ~ 893 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22801

Enviar uma mensagem


ITGA11 polyclonal antibody (A01)

ITGA11 polyclonal antibody (A01)