RRAS2 purified MaxPab rabbit polyclonal antibody (D01P)
  • RRAS2 purified MaxPab rabbit polyclonal antibody (D01P)

RRAS2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022800-D01P
RRAS2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RRAS2 protein.
Información adicional
Size 100 ug
Gene Name RRAS2
Gene Alias TC21
Gene Description related RAS viral (r-ras) oncogene homolog 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RRAS2 (NP_036382.2, 1 a.a. ~ 204 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22800

Enviar uma mensagem


RRAS2 purified MaxPab rabbit polyclonal antibody (D01P)

RRAS2 purified MaxPab rabbit polyclonal antibody (D01P)