TFEC monoclonal antibody (M08), clone 4F11
  • TFEC monoclonal antibody (M08), clone 4F11

TFEC monoclonal antibody (M08), clone 4F11

Ref: AB-H00022797-M08
TFEC monoclonal antibody (M08), clone 4F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant TFEC.
Información adicional
Size 100 ug
Gene Name TFEC
Gene Alias TCFEC|TFECL|bHLHe34
Gene Description transcription factor EC
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHLSGSILDVYSGEQGISPINMGLTSASCPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TFEC (NP_001018068.1, 1 a.a. ~ 89 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22797
Clone Number 4F11
Iso type IgG2a Kappa

Enviar uma mensagem


TFEC monoclonal antibody (M08), clone 4F11

TFEC monoclonal antibody (M08), clone 4F11