COG2 monoclonal antibody (M09), clone 4C8
  • COG2 monoclonal antibody (M09), clone 4C8

COG2 monoclonal antibody (M09), clone 4C8

Ref: AB-H00022796-M09
COG2 monoclonal antibody (M09), clone 4C8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COG2.
Información adicional
Size 100 ug
Gene Name COG2
Gene Alias LDLC
Gene Description component of oligomeric golgi complex 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,RNAi-Ab
Immunogen Prot. Seq LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COG2 (NP_031383, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22796
Clone Number 4C8
Iso type IgG2b Kappa

Enviar uma mensagem


COG2 monoclonal antibody (M09), clone 4C8

COG2 monoclonal antibody (M09), clone 4C8