COG2 purified MaxPab rabbit polyclonal antibody (D01P)
  • COG2 purified MaxPab rabbit polyclonal antibody (D01P)

COG2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022796-D01P
COG2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human COG2 protein.
Información adicional
Size 100 ug
Gene Name COG2
Gene Alias LDLC
Gene Description component of oligomeric golgi complex 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKSRMNLPKGPDTLCFDKDEFMKEDFDVDHFVSDCRKRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQLSVPLGQLREEVLSLRSSVSEGIRAVDERMSKQEDIRKKKMCVLRLIQVIRSVEKIEKILNSQSSKETSALEASSPLLTGQILERIATEFNQLQFHAVQSKGMPLLDKVRPRIAGITAMLQQSLEGLLLEGLQTSDVDIIRHCLRTYATIDKTRDAEALVGQVLVKPY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COG2 (NP_031383.1, 1 a.a. ~ 738 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22796

Enviar uma mensagem


COG2 purified MaxPab rabbit polyclonal antibody (D01P)

COG2 purified MaxPab rabbit polyclonal antibody (D01P)