RNF13 monoclonal antibody (M02), clone 3E4
  • RNF13 monoclonal antibody (M02), clone 3E4

RNF13 monoclonal antibody (M02), clone 3E4

Ref: AB-H00011342-M02
RNF13 monoclonal antibody (M02), clone 3E4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF13.
Información adicional
Size 100 ug
Gene Name RNF13
Gene Alias FLJ93817|MGC13689|RZF
Gene Description ring finger protein 13
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq LPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIEVLKKIDIPSVFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF13 (NP_009213, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11342
Clone Number 3E4
Iso type IgG2a Kappa

Enviar uma mensagem


RNF13 monoclonal antibody (M02), clone 3E4

RNF13 monoclonal antibody (M02), clone 3E4