OIP5 polyclonal antibody (A01)
  • OIP5 polyclonal antibody (A01)

OIP5 polyclonal antibody (A01)

Ref: AB-H00011339-A01
OIP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant OIP5.
Información adicional
Size 50 uL
Gene Name OIP5
Gene Alias 5730547N13Rik|LINT-25|MIS18beta
Gene Description Opa interacting protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen OIP5 (AAH15050, 1 a.a. ~ 229 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11339

Enviar uma mensagem


OIP5 polyclonal antibody (A01)

OIP5 polyclonal antibody (A01)