EXOC3 monoclonal antibody (M01), clone 4A7
  • EXOC3 monoclonal antibody (M01), clone 4A7

EXOC3 monoclonal antibody (M01), clone 4A7

Ref: AB-H00011336-M01
EXOC3 monoclonal antibody (M01), clone 4A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EXOC3.
Información adicional
Size 100 ug
Gene Name EXOC3
Gene Alias SEC6|SEC6L1|Sec6p
Gene Description exocyst complex component 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EXOC3 (NP_009208, 646 a.a. ~ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11336
Clone Number 4A7
Iso type IgG2b Kappa

Enviar uma mensagem


EXOC3 monoclonal antibody (M01), clone 4A7

EXOC3 monoclonal antibody (M01), clone 4A7