TUSC2 polyclonal antibody (A01)
  • TUSC2 polyclonal antibody (A01)

TUSC2 polyclonal antibody (A01)

Ref: AB-H00011334-A01
TUSC2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant TUSC2.
Información adicional
Size 50 uL
Gene Name TUSC2
Gene Alias C3orf11|FUS1|PAP|PDAP2
Gene Description tumor suppressor candidate 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TUSC2 (NP_009206, 31 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11334

Enviar uma mensagem


TUSC2 polyclonal antibody (A01)

TUSC2 polyclonal antibody (A01)