STK38 monoclonal antibody (M05), clone 6G11 View larger

Mouse monoclonal antibody raised against a partial recombinant STK38.

AB-H00011329-M05

New product

STK38 monoclonal antibody (M05), clone 6G11

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 100 ug
Gene Name STK38
Gene Alias NDR|NDR1
Gene Description serine/threonine kinase 38
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq EHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen STK38 (AAH12085, 365 a.a. ~ 465 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11329
Clone Number 6G11
Iso type IgG2a Kappa

More info

Mouse monoclonal antibody raised against a partial recombinant STK38.

Enviar uma mensagem

Mouse monoclonal antibody raised against a partial recombinant STK38.

Mouse monoclonal antibody raised against a partial recombinant STK38.