COPE polyclonal antibody (A01)
  • COPE polyclonal antibody (A01)

COPE polyclonal antibody (A01)

Ref: AB-H00011316-A01
COPE polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COPE.
Información adicional
Size 50 uL
Gene Name COPE
Gene Alias FLJ13241|epsilon-COP
Gene Description coatomer protein complex, subunit epsilon
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPE (NP_009194, 211 a.a. ~ 308 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11316

Enviar uma mensagem


COPE polyclonal antibody (A01)

COPE polyclonal antibody (A01)