LYPLA2 monoclonal antibody (M01), clone 3H5
  • LYPLA2 monoclonal antibody (M01), clone 3H5

LYPLA2 monoclonal antibody (M01), clone 3H5

Ref: AB-H00011313-M01
LYPLA2 monoclonal antibody (M01), clone 3H5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LYPLA2.
Información adicional
Size 100 ug
Gene Name LYPLA2
Gene Alias APT-2|DJ886K2.4
Gene Description lysophospholipase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq ALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LYPLA2 (NP_009191, 144 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11313
Clone Number 3H5
Iso type IgG2b Kappa

Enviar uma mensagem


LYPLA2 monoclonal antibody (M01), clone 3H5

LYPLA2 monoclonal antibody (M01), clone 3H5