POU6F2 monoclonal antibody (M08), clone 8F9
  • POU6F2 monoclonal antibody (M08), clone 8F9

POU6F2 monoclonal antibody (M08), clone 8F9

Ref: AB-H00011281-M08
POU6F2 monoclonal antibody (M08), clone 8F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant POU6F2.
Información adicional
Size 100 ug
Gene Name POU6F2
Gene Alias RPF-1|WT5|WTSL
Gene Description POU class 6 homeobox 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IAGQVSKPLLSVRSEMNAELRGEDKAATSDSELNEPLLAPVESNDSEDTPSKLFGARGNPALSDPGTPDQHQASQTHPPFPVGPQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POU6F2 (NP_009183, 2 a.a. ~ 87 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11281
Clone Number 8F9
Iso type IgG2a Kappa

Enviar uma mensagem


POU6F2 monoclonal antibody (M08), clone 8F9

POU6F2 monoclonal antibody (M08), clone 8F9