KLF8 monoclonal antibody (M09), clone 2E10
  • KLF8 monoclonal antibody (M09), clone 2E10

KLF8 monoclonal antibody (M09), clone 2E10

Ref: AB-H00011279-M09
KLF8 monoclonal antibody (M09), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF8.
Información adicional
Size 100 ug
Gene Name KLF8
Gene Alias BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741
Gene Description Kruppel-like factor 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF8 (NP_009181.1, 1 a.a. ~ 98 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11279
Clone Number 2E10
Iso type IgG2a Kappa

Enviar uma mensagem


KLF8 monoclonal antibody (M09), clone 2E10

KLF8 monoclonal antibody (M09), clone 2E10