KLF8 purified MaxPab mouse polyclonal antibody (B01P)
  • KLF8 purified MaxPab mouse polyclonal antibody (B01P)

KLF8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011279-B01P
KLF8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human KLF8 protein.
Información adicional
Size 50 ug
Gene Name KLF8
Gene Alias BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741
Gene Description Kruppel-like factor 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLF8 (NP_009181.2, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11279

Enviar uma mensagem


KLF8 purified MaxPab mouse polyclonal antibody (B01P)

KLF8 purified MaxPab mouse polyclonal antibody (B01P)