PRR4 monoclonal antibody (M02), clone 1D2
  • PRR4 monoclonal antibody (M02), clone 1D2

PRR4 monoclonal antibody (M02), clone 1D2

Ref: AB-H00011272-M02
PRR4 monoclonal antibody (M02), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PRR4.
Información adicional
Size 100 ug
Gene Name PRR4
Gene Alias DKFZp779L1763|LPRP|PROL4
Gene Description proline rich 4 (lacrimal)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq QSTDNDVNYEDFTFTIPDVEDSSQRPDQGPQRPPPEGLLPRPPGDSGNQDDGPQQRPPKPGGHHRHPPPPPFQNQQRPPQRGHRQLSLPRFPSVSLQEAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PRR4 (NP_009175.1, 17 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11272
Clone Number 1D2
Iso type IgG2a Kappa

Enviar uma mensagem


PRR4 monoclonal antibody (M02), clone 1D2

PRR4 monoclonal antibody (M02), clone 1D2