DUSP12 purified MaxPab mouse polyclonal antibody (B01P)
  • DUSP12 purified MaxPab mouse polyclonal antibody (B01P)

DUSP12 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011266-B01P
DUSP12 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DUSP12 protein.
Información adicional
Size 50 ug
Gene Name DUSP12
Gene Alias DUSP1|YVH1
Gene Description dual specificity phosphatase 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr
Immunogen Prot. Seq MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQELFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKRMTPSS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DUSP12 (NP_009171.1, 1 a.a. ~ 340 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11266

Enviar uma mensagem


DUSP12 purified MaxPab mouse polyclonal antibody (B01P)

DUSP12 purified MaxPab mouse polyclonal antibody (B01P)