DUSP12 polyclonal antibody (A01)
  • DUSP12 polyclonal antibody (A01)

DUSP12 polyclonal antibody (A01)

Ref: AB-H00011266-A01
DUSP12 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DUSP12.
Información adicional
Size 50 uL
Gene Name DUSP12
Gene Alias DUSP1|YVH1
Gene Description dual specificity phosphatase 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SSSILDHREGSGPIAFAHKRMTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSFNWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP12 (NP_009171, 231 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11266

Enviar uma mensagem


DUSP12 polyclonal antibody (A01)

DUSP12 polyclonal antibody (A01)