SP140 monoclonal antibody (M07), clone 3F9
  • SP140 monoclonal antibody (M07), clone 3F9

SP140 monoclonal antibody (M07), clone 3F9

Ref: AB-H00011262-M07
SP140 monoclonal antibody (M07), clone 3F9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SP140.
Información adicional
Size 100 ug
Gene Name SP140
Gene Alias LYSP100|LYSP100-A|LYSP100-B|MGC126440
Gene Description SP140 nuclear body protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq GHGWSRMRMRRQKNSQQNDNSKADGQVVSSEKKANVNLKDLSKIRGRKRGKPGTRFTQSDRAAQKRVRSRASRKHKDETVDFKAPLLPVTCGGVKGILHKKKLQQGILV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SP140 (NP_009168.3, 504 a.a. ~ 612 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11262
Clone Number 3F9
Iso type IgG2a Kappa

Enviar uma mensagem


SP140 monoclonal antibody (M07), clone 3F9

SP140 monoclonal antibody (M07), clone 3F9