SP140 purified MaxPab mouse polyclonal antibody (B01P)
  • SP140 purified MaxPab mouse polyclonal antibody (B01P)

SP140 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011262-B01P
SP140 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SP140 protein.
Información adicional
Size 50 ug
Gene Name SP140
Gene Alias LYSP100|LYSP100-A|LYSP100-B|MGC126440
Gene Description SP140 nuclear body protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAQQGQQGQMASGDSNLNFRMVAEIQNVEGQNLQEQVCPEPIFRFFRENKVEIASAITRPFPFLMGLRDRSFISEQMYEHFQEAFRNLVPVTRVMYCVLSELEKTFGWSHLEALFSRINLMAYPDLNEIYRSFQNENLSSSAVLCQLVSPNKDWRSHEESLAHTGTLRRSCM
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SP140 (NP_001005176.1, 1 a.a. ~ 172 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11262

Enviar uma mensagem


SP140 purified MaxPab mouse polyclonal antibody (B01P)

SP140 purified MaxPab mouse polyclonal antibody (B01P)