CHP monoclonal antibody (M01A), clone 3G8
  • CHP monoclonal antibody (M01A), clone 3G8

CHP monoclonal antibody (M01A), clone 3G8

Ref: AB-H00011261-M01A
CHP monoclonal antibody (M01A), clone 3G8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant CHP.
Información adicional
Size 200 uL
Gene Name CHP
Gene Alias SLC9A1BP
Gene Description calcium binding protein P22
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MESHSVTQAGVQWRDLGSLQPLPPGFKQFSHLSLPSSWDYRRVPPYLGNFCIFSGEGVSPCWPGWS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CHP (AAH08373, 1 a.a. ~ 66 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 11261
Clone Number 3G8
Iso type IgG2a Kappa

Enviar uma mensagem


CHP monoclonal antibody (M01A), clone 3G8

CHP monoclonal antibody (M01A), clone 3G8