PACSIN2 monoclonal antibody (M05), clone 3D6
  • PACSIN2 monoclonal antibody (M05), clone 3D6

PACSIN2 monoclonal antibody (M05), clone 3D6

Ref: AB-H00011252-M05
PACSIN2 monoclonal antibody (M05), clone 3D6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PACSIN2.
Información adicional
Size 100 ug
Gene Name PACSIN2
Gene Alias SDPII
Gene Description protein kinase C and casein kinase substrate in neurons 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq DDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFDDDATSGTE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PACSIN2 (NP_009160.1, 368 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11252
Clone Number 3D6
Iso type IgG2a Kappa

Enviar uma mensagem


PACSIN2 monoclonal antibody (M05), clone 3D6

PACSIN2 monoclonal antibody (M05), clone 3D6