NXPH4 purified MaxPab mouse polyclonal antibody (B01P)
  • NXPH4 purified MaxPab mouse polyclonal antibody (B01P)

NXPH4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011247-B01P
NXPH4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human NXPH4 protein.
Información adicional
Size 50 ug
Gene Name NXPH4
Gene Alias NPH4
Gene Description neurexophilin 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRLLPEWFLLLFGPWLLRKAVSAQIPESGRPQYLGLRPAAAGAGAPGQQLPEPRSSDGLGVGRAWSWAWPTNHTGALARAGAAGALPAQRTKRKPSIKAARAKKIFGWGDFYFRVHTLKFSLLVTGKIVDHVNGTFSVYFRHNSSSLGNLSVSIVPPSKRVEFGGVWLPGPVPHPLQSTLALEGVLPGLGPPLGMAAAAAGPGLGGSLGGALAGPLGGALGVPGAKESRAFNCHVEYEKTNRARKHRPCLYDPSQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NXPH4 (NP_009155, 1 a.a. ~ 308 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11247

Enviar uma mensagem


NXPH4 purified MaxPab mouse polyclonal antibody (B01P)

NXPH4 purified MaxPab mouse polyclonal antibody (B01P)