Língua:
Português
Español
Português
Español
Português
Pesquisar
Iniciar sesión
REAGENTES
INSTRUMENTOS
Consumiveis
OFERTAS
APRESENTOU
FABRICANTES
Publicações Científicas
DOWNLOADS
NEWSLETTERS
BIOGEN Científica
Reagentes
ABNOVA
Antibody
ZHX1 monoclonal antibody (M01), clone 5E5
Abnova
ZHX1 monoclonal antibody (M01), clone 5E5
Ref: AB-H00011244-M01
ZHX1 monoclonal antibody (M01), clone 5E5
Contacte-nos
Información del producto
Mouse monoclonal antibody raised against a partial recombinant ZHX1.
Información adicional
Size
100 ug
Gene Name
ZHX1
Gene Alias
-
Gene Description
zinc fingers and homeoboxes 1
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
S-ELISA,ELISA
Immunogen Prot. Seq
SSSMNGLSSLRKRGRGRPKGRGRGRPRGRPRGSKRINNWDRGPSLIKFKTGTAILKDYYLKRKFLNEQDLDELVNKSHMGYEQVREWFAERQRRSELGI
Antigen species Target species
Human
Quality control testing
Antibody Reactive Against Recombinant Protein.
Immunogen
ZHX1 (NP_009153, 731 a.a. ~ 829 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
11244
Clone Number
5E5
Iso type
IgG2a Kappa
Enviar uma mensagem
ZHX1 monoclonal antibody (M01), clone 5E5
Nome
*
Sobrenomes
*
E-mail
*
Centro de Investigação
*
Departamento
Número de Telefone
*
Mensagem de consulta de produto
*