PADI2 monoclonal antibody (M01), clone 4D4
  • PADI2 monoclonal antibody (M01), clone 4D4

PADI2 monoclonal antibody (M01), clone 4D4

Ref: AB-H00011240-M01
PADI2 monoclonal antibody (M01), clone 4D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PADI2.
Información adicional
Size 100 ug
Gene Name PADI2
Gene Alias KIAA0994|PAD-H19|PAD2|PDI2
Gene Description peptidyl arginine deiminase, type II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PADI2 (NP_003008, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11240
Clone Number 4D4
Iso type IgG1 Kappa

Enviar uma mensagem


PADI2 monoclonal antibody (M01), clone 4D4

PADI2 monoclonal antibody (M01), clone 4D4