PADI2 polyclonal antibody (A01)
  • PADI2 polyclonal antibody (A01)

PADI2 polyclonal antibody (A01)

Ref: AB-H00011240-A01
PADI2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PADI2.
Información adicional
Size 50 uL
Gene Name PADI2
Gene Alias KIAA0994|PAD-H19|PAD2|PDI2
Gene Description peptidyl arginine deiminase, type II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PADI2 (NP_003008, 1 a.a. ~ 108 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11240

Enviar uma mensagem


PADI2 polyclonal antibody (A01)

PADI2 polyclonal antibody (A01)