CA5B polyclonal antibody (A01)
  • CA5B polyclonal antibody (A01)

CA5B polyclonal antibody (A01)

Ref: AB-H00011238-A01
CA5B polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CA5B.
Información adicional
Size 50 uL
Gene Name CA5B
Gene Alias CA-VB|MGC39962
Gene Description carbonic anhydrase VB, mitochondrial
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CA5B (NP_009151, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11238

Enviar uma mensagem


CA5B polyclonal antibody (A01)

CA5B polyclonal antibody (A01)