RNF24 monoclonal antibody (M01), clone 4C6
  • RNF24 monoclonal antibody (M01), clone 4C6

RNF24 monoclonal antibody (M01), clone 4C6

Ref: AB-H00011237-M01
RNF24 monoclonal antibody (M01), clone 4C6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RNF24.
Información adicional
Size 100 ug
Gene Name RNF24
Gene Alias G1L
Gene Description ring finger protein 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq LRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF24 (NP_009150, 49 a.a. ~ 148 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11237
Clone Number 4C6
Iso type IgG2b Kappa

Enviar uma mensagem


RNF24 monoclonal antibody (M01), clone 4C6

RNF24 monoclonal antibody (M01), clone 4C6