RNF24 polyclonal antibody (A01)
  • RNF24 polyclonal antibody (A01)

RNF24 polyclonal antibody (A01)

Ref: AB-H00011237-A01
RNF24 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant RNF24.
Información adicional
Size 50 uL
Gene Name RNF24
Gene Alias G1L
Gene Description ring finger protein 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRGPPQGPLPGAENIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF24 (NP_009150, 49 a.a. ~ 148 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11237

Enviar uma mensagem


RNF24 polyclonal antibody (A01)

RNF24 polyclonal antibody (A01)