SEC63 monoclonal antibody (M04), clone 1A8
  • SEC63 monoclonal antibody (M04), clone 1A8

SEC63 monoclonal antibody (M04), clone 1A8

Ref: AB-H00011231-M04
SEC63 monoclonal antibody (M04), clone 1A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEC63.
Información adicional
Size 100 ug
Gene Name SEC63
Gene Alias ERdj2|PRO2507|SEC63L
Gene Description SEC63 homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq KSKITHPVYSLYFPEEKQEWWWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRSDSYMGLDQIKPLKLEVHEAKPVPENHPQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEC63 (NP_009145.1, 631 a.a. ~ 728 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11231
Clone Number 1A8
Iso type IgG2a Kappa

Enviar uma mensagem


SEC63 monoclonal antibody (M04), clone 1A8

SEC63 monoclonal antibody (M04), clone 1A8