GALNT6 MaxPab rabbit polyclonal antibody (D01)
  • GALNT6 MaxPab rabbit polyclonal antibody (D01)

GALNT6 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011226-D01
GALNT6 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human GALNT6 protein.
Información adicional
Size 100 uL
Gene Name GALNT6
Gene Alias GALNAC-T6|GalNAcT6
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MRLLRRRHMPLRLAMVGCAFVLFLFLLHRDVSSREEATEKPWLKSLVSRKDHVLDLMLEAMNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAFQKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTSVIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVRVVRQEERKGLITARLL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen GALNT6 (NP_009141.2, 1 a.a. ~ 622 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11226

Enviar uma mensagem


GALNT6 MaxPab rabbit polyclonal antibody (D01)

GALNT6 MaxPab rabbit polyclonal antibody (D01)