GALNT6 polyclonal antibody (A01)
  • GALNT6 polyclonal antibody (A01)

GALNT6 polyclonal antibody (A01)

Ref: AB-H00011226-A01
GALNT6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant GALNT6.
Información adicional
Size 50 uL
Gene Name GALNT6
Gene Alias GALNAC-T6|GalNAcT6
Gene Description UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq IMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GALNT6 (NP_009141, 523 a.a. ~ 622 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11226

Enviar uma mensagem


GALNT6 polyclonal antibody (A01)

GALNT6 polyclonal antibody (A01)