DUSP10 polyclonal antibody (A01)
  • DUSP10 polyclonal antibody (A01)

DUSP10 polyclonal antibody (A01)

Ref: AB-H00011221-A01
DUSP10 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant DUSP10.
Información adicional
Size 50 uL
Gene Name DUSP10
Gene Alias MKP-5|MKP5
Gene Description dual specificity phosphatase 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGVETVV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DUSP10 (AAH20608, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11221

Enviar uma mensagem


DUSP10 polyclonal antibody (A01)

DUSP10 polyclonal antibody (A01)