DDX20 purified MaxPab mouse polyclonal antibody (B01P)
  • DDX20 purified MaxPab mouse polyclonal antibody (B01P)

DDX20 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011218-B01P
DDX20 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DDX20 protein.
Información adicional
Size 50 ug
Gene Name DDX20
Gene Alias DKFZp434H052|DP103|GEMIN3
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MAAAFEASGALAAVATAMPAEHVAVQVPAPEPTPGPVRILRTAQDLSSPRTRTGDVLLAEPADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLDLIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTREIAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKCHIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGSFQEQINWIYSSLPASKQMLAVSATYPEFLANALT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DDX20 (AAH34953.1, 1 a.a. ~ 824 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11218

Enviar uma mensagem


DDX20 purified MaxPab mouse polyclonal antibody (B01P)

DDX20 purified MaxPab mouse polyclonal antibody (B01P)