AKAP10 monoclonal antibody (M04), clone 8C10
  • AKAP10 monoclonal antibody (M04), clone 8C10

AKAP10 monoclonal antibody (M04), clone 8C10

Ref: AB-H00011216-M04
AKAP10 monoclonal antibody (M04), clone 8C10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant AKAP10.
Información adicional
Size 100 ug
Gene Name AKAP10
Gene Alias D-AKAP2|MGC9414|PRKA10
Gene Description A kinase (PRKA) anchor protein 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq MRGAGPSPRQSPRTLRPDPGPAMSFFRRKVKGKEQEKTSDVKSIKASISVHSPQKSTKNHALLEAAGPSHVAINAISANMDSFSSSRTATLKKQPSHMEA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP10 (NP_009133, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11216
Clone Number 8C10
Iso type IgG2a Kappa

Enviar uma mensagem


AKAP10 monoclonal antibody (M04), clone 8C10

AKAP10 monoclonal antibody (M04), clone 8C10