AKAP11 polyclonal antibody (A01)
  • AKAP11 polyclonal antibody (A01)

AKAP11 polyclonal antibody (A01)

Ref: AB-H00011215-A01
AKAP11 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant AKAP11.
Información adicional
Size 50 uL
Gene Name AKAP11
Gene Alias AKAP220|DKFZp781I12161|FLJ11304|KIAA0629|PRKA11
Gene Description A kinase (PRKA) anchor protein 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EGLGQDGKTLLITNIDMEPCTVDPQLRIILQWLIASEAEVAELYFHDSANKEFMLLSKQLQEKGWKVGDLLQAVLQYYEVMEKASSEERCKSLFDWLLENA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen AKAP11 (NP_057332, 1801 a.a. ~ 1901 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11215

Enviar uma mensagem


AKAP11 polyclonal antibody (A01)

AKAP11 polyclonal antibody (A01)