IRAK3 monoclonal antibody (M07), clone 1C9
  • IRAK3 monoclonal antibody (M07), clone 1C9

IRAK3 monoclonal antibody (M07), clone 1C9

Ref: AB-H00011213-M07
IRAK3 monoclonal antibody (M07), clone 1C9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IRAK3.
Información adicional
Size 100 ug
Gene Name IRAK3
Gene Alias ASRT5|FLJ13601|IRAK-M|IRAKM
Gene Description interleukin-1 receptor-associated kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAGNWGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSRLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEALLLFHHPSILELAAYFTETEKFCLIYPYMRNGTLFDRLQC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRAK3 (AAH57800, 1 a.a. ~ 596 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11213
Clone Number 1C9
Iso type IgG1 Kappa

Enviar uma mensagem


IRAK3 monoclonal antibody (M07), clone 1C9

IRAK3 monoclonal antibody (M07), clone 1C9