IRAK3 purified MaxPab rabbit polyclonal antibody (D01P)
  • IRAK3 purified MaxPab rabbit polyclonal antibody (D01P)

IRAK3 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011213-D01P
IRAK3 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRAK3 protein.
Información adicional
Size 100 ug
Gene Name IRAK3
Gene Alias ASRT5|FLJ13601|IRAK-M|IRAKM
Gene Description interleukin-1 receptor-associated kinase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGVLLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRAK3 (NP_009130.1, 1 a.a. ~ 596 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11213

Enviar uma mensagem


IRAK3 purified MaxPab rabbit polyclonal antibody (D01P)

IRAK3 purified MaxPab rabbit polyclonal antibody (D01P)