PROSC monoclonal antibody (M02), clone 2G1
  • PROSC monoclonal antibody (M02), clone 2G1

PROSC monoclonal antibody (M02), clone 2G1

Ref: AB-H00011212-M02
PROSC monoclonal antibody (M02), clone 2G1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PROSC.
Información adicional
Size 100 ug
Gene Name PROSC
Gene Alias FLJ11861
Gene Description proline synthetase co-transcribed homolog (bacterial)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PROSC (NP_009129.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11212
Clone Number 2G1
Iso type IgG2b Kappa

Enviar uma mensagem


PROSC monoclonal antibody (M02), clone 2G1

PROSC monoclonal antibody (M02), clone 2G1