AB-H00011212-B01P
New product
This product is no longer in stock
Availability date:
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Size | 50 ug |
Gene Name | PROSC |
Gene Alias | FLJ11861 |
Gene Description | proline synthetase co-transcribed homolog (bacterial) |
Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
Application Key | WB-Ti,WB-Tr |
Immunogen Prot. Seq | MWRAGSMSAELGVGCALRAVNERVQQAVARRPRDLPAIQPRLVAVSKTKPADMVIEAYGHGQRTFGENYVQELLEKASNPKILSLCPEIKWHFIGHLQKQNVNKLMAVPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMTIGSFGHDLSQGPNPDFQLLLSLREELCKKLNIPADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKK |
Antigen species Target species | Human |
Quality control testing | Antibody reactive against mammalian transfected lysate. |
Immunogen | PROSC (NP_009129.1, 1 a.a. ~ 275 a.a) full-length human protein. |
Storage Buffer | In 1x PBS, pH 7.4 |
Gene ID | 11212 |