WIF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • WIF1 purified MaxPab rabbit polyclonal antibody (D01P)

WIF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011197-D01P
WIF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WIF1 protein.
Información adicional
Size 100 ug
Gene Name WIF1
Gene Alias WIF-1
Gene Description WNT inhibitory factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WIF1 (AAH18037.1, 1 a.a. ~ 379 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11197

Enviar uma mensagem


WIF1 purified MaxPab rabbit polyclonal antibody (D01P)

WIF1 purified MaxPab rabbit polyclonal antibody (D01P)