WIF1 polyclonal antibody (A01)
  • WIF1 polyclonal antibody (A01)

WIF1 polyclonal antibody (A01)

Ref: AB-H00011197-A01
WIF1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant WIF1.
Información adicional
Size 50 uL
Gene Name WIF1
Gene Alias WIF-1
Gene Description WNT inhibitory factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WIF1 (NP_009122, 29 a.a. ~ 138 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11197

Enviar uma mensagem


WIF1 polyclonal antibody (A01)

WIF1 polyclonal antibody (A01)