SEC23IP MaxPab mouse polyclonal antibody (B02) View larger

Mouse polyclonal antibody raised against a full-length human SEC23IP protein.

AB-H00011196-B02

New product

SEC23IP MaxPab mouse polyclonal antibody (B02)

More details

Registe-se for viewing this price!

Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.


Data sheet

Size 50 uL
Gene Name SEC23IP
Gene Alias MSTP053|P125
Gene Description SEC23 interacting protein
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTALPFTTGSQDVSNAFSPSISKAQPGAPPSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPYIAPPQLQQCQTPGPPAHPPPSGPPVQMYQMPPGSLPPVPSSVQSPAQQQVPARPGAPSVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEC23IP (NP_009121, 1 a.a. ~ 1000 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11196

More info

Mouse polyclonal antibody raised against a full-length human SEC23IP protein.

Enviar uma mensagem

Mouse polyclonal antibody raised against a full-length human SEC23IP protein.

Mouse polyclonal antibody raised against a full-length human SEC23IP protein.