SEC23IP purified MaxPab mouse polyclonal antibody (B01P)
  • SEC23IP purified MaxPab mouse polyclonal antibody (B01P)

SEC23IP purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011196-B01P
SEC23IP purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SEC23IP protein.
Información adicional
Size 50 ug
Gene Name SEC23IP
Gene Alias MSTP053|P125
Gene Description SEC23 interacting protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MAERKPNGGSGGASTSSSGTNLLFSSSATEFSFNVPFIPVTQASASPASLLLPGEDSTDVGEEDSFLGQTSIHTSAPQTFSYFSQVSSSSDPFGNIGQSPLTTAATSVGQSGFPKPLTALPFTTGSQDVSNAFSPSISKAQPGAPPSSLMGINSYLPSQPSSLPPSYFGNQPQGIPQPGYNPYRHTPGSSRANPYIAPPQLQQCQTPGPPAHPPPSGPPVQMYQMPPGSLPPVPSSVQSPAQQQVPARPGAPSVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEC23IP (N/A, 1 a.a. ~ 486 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11196

Enviar uma mensagem


SEC23IP purified MaxPab mouse polyclonal antibody (B01P)

SEC23IP purified MaxPab mouse polyclonal antibody (B01P)