PKP3 polyclonal antibody (A01)
  • PKP3 polyclonal antibody (A01)

PKP3 polyclonal antibody (A01)

Ref: AB-H00011187-A01
PKP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PKP3.
Información adicional
Size 50 uL
Gene Name PKP3
Gene Alias -
Gene Description plakophilin 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPSVRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKP3 (NP_009114, 225 a.a. ~ 324 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11187

Enviar uma mensagem


PKP3 polyclonal antibody (A01)

PKP3 polyclonal antibody (A01)