INMT polyclonal antibody (A01)
  • INMT polyclonal antibody (A01)

INMT polyclonal antibody (A01)

Ref: AB-H00011185-A01
INMT polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant INMT.
Información adicional
Size 50 uL
Gene Name INMT
Gene Alias MGC125940|MGC125941
Gene Description indolethylamine N-methyltransferase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DAYRAALCNLASLLKPGGHLVTTVTLRLPSYMVGKREFSCVALEKGEVEQAVLDAGFDIEQLLHSPQSYSVTNAANNGVCCIVARKKPGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INMT (NP_006765, 174 a.a. ~ 263 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11185

Enviar uma mensagem


INMT polyclonal antibody (A01)

INMT polyclonal antibody (A01)