MAP4K1 monoclonal antibody (M02), clone 1G6
  • MAP4K1 monoclonal antibody (M02), clone 1G6

MAP4K1 monoclonal antibody (M02), clone 1G6

Ref: AB-H00011184-M02
MAP4K1 monoclonal antibody (M02), clone 1G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAP4K1.
Información adicional
Size 100 ug
Gene Name MAP4K1
Gene Alias HPK1
Gene Description mitogen-activated protein kinase kinase kinase kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GLNRGLILDLLDKLKNPGKGPSIGDIEDEEPELPPAIPRRIRSTHRSSSLGIPDADCCRRHMEFRKLRGMETRPPANTARLQPPRDLRSSSPRKQLSESS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAP4K1 (NP_009112, 278 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11184
Clone Number 1G6
Iso type IgG1 Kappa

Enviar uma mensagem


MAP4K1 monoclonal antibody (M02), clone 1G6

MAP4K1 monoclonal antibody (M02), clone 1G6